TOM1 antibody

Catalog No. ABIN632634

The Rabbit Polyclonal anti-TOM1 antibody (ABIN632634) specifically detects TOM1 in WB. The antibody is reactive with Human samples.

Quick Overview for TOM1 antibody (ABIN632634)

Target: TOM1 (Target of Myb 1 (TOM1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TOM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TOM1 Antibody

Purification: Affinity purified

Immunogen: TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TOM1 Blocking Peptide, (ABIN5616727), is also available for use as a blocking control in assays to test for specificity of this TOM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TOM1

Target: TOM1 (Target of Myb 1 (TOM1))

Alternative Name: TOM1

Background: This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 54 kDa (MW of target protein)