Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP) (N-Term) antibody

Catalog No. ABIN632668

This Rabbit Polyclonal antibody specifically detects Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein in WB. It exhibits reactivity toward Human.

Quick Overview for Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP) (N-Term) antibody (ABIN632668)

Target: Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: APBB1 IP antibody was raised against the N terminal Of Apbb1 p

Purification: Affinity purified

Immunogen: APBB1 IP antibody was raised using the N terminal Of Apbb1 p corresponding to a region with amino acids LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APBB1IP Blocking Peptide, (ABIN5612101), is also available for use as a blocking control in assays to test for specificity of this APBB1IP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)

Alternative Name: APBB1IP

Background: APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.

Molecular Weight: 73 kDa (MW of target protein)