PGAM2 antibody
-
- Target See all PGAM2 Antibodies
- PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PGAM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDT
- Top Product
- Discover our top product PGAM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PGAM2 Blocking Peptide, catalog no. 33R-2682, is also available for use as a blocking control in assays to test for specificity of this PGAM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGAM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGAM2 (phosphoglycerate Mutase 2 (Muscle) (PGAM2))
- Alternative Name
- PGAM2 (PGAM2 Products)
- Synonyms
- zgc:63876 antibody, GSD10 antibody, PGAM-M antibody, PGAMM antibody, D14Mgh1 antibody, Pgmut antibody, phosphoglycerate mutase 2 antibody, phosphoglycerate mutase 2 (muscle) antibody, phosphoglycerate mutase 2 L homeolog antibody, Pgam2 antibody, PGAM2 antibody, pgam2 antibody, pgam2.L antibody
- Background
- PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
- Molecular Weight
- 29 kDa (MW of target protein)
-