UGP2 antibody (N-Term)

Catalog No. ABIN632677

Product Details anti-UGP2 Antibody

Target: UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGP2 antibody was raised against the N terminal of µgP2

Purification: Affinity purified

Immunogen: UGP2 antibody was raised using the N terminal of µgP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGP2 Blocking Peptide, catalog no. 33R-9141, is also available for use as a blocking control in assays to test for specificity of this µgP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGP2

Target: UGP2 (UDP-Glucose Pyrophosphorylase 2 (UGP2))

Alternative Name: UGP2 (UGP2 Products)

Synonyms: DDBDRAFT_0204359 antibody, DDBDRAFT_0214911 antibody, DDB_0204359 antibody, DDB_0214911 antibody, UDPG antibody, UDPGP antibody, UDPGP2 antibody, UGP1 antibody, UGPP1 antibody, UGPP2 antibody, pHC379 antibody, Ugp2 antibody, fi53h10 antibody, wu:fi53h10 antibody, zgc:85662 antibody, AtUGP1 antibody, T17B22.6 antibody, T17B22_6 antibody, UDP-GLUCOSE PYROPHOSPHORYLASE 1 antibody, UDP-glucose pyrophosphorylase antibody, UGP antibody, UGPASE antibody, UGPase antibody, UDP-glucose pyrophosphorylase 2 antibody, UDP-glucose pyrophosphorylase 2 L homeolog antibody, UDP-glucose pyrophosphorylase 2b antibody, UDP-GLUCOSE PYROPHOSPHORYLASE 1 antibody, UDP-glucose pyrophosphorylase precursor antibody, ugpB antibody, ugp2.L antibody, UGP2 antibody, Ugp2 antibody, ugp2b antibody, LOAG_08596 antibody, DICPUDRAFT_55932 antibody, UGP1 antibody, LOC102577726 antibody

Background: UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen, in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process