ACOT12 antibody (Middle Region)

Catalog No. ABIN632711

Product Details anti-ACOT12 Antibody

Target: ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACOT12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACOT12 antibody was raised against the middle region of ACOT12

Purification: Affinity purified

Immunogen: ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACOT12 Blocking Peptide, catalog no. 33R-8317, is also available for use as a blocking control in assays to test for specificity of this ACOT12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACOT12

Target: ACOT12 (Acyl-CoA Thioesterase 12 (ACOT12))

Alternative Name: ACOT12 (ACOT12 Products)

Synonyms: MGC189641 antibody, CACH-1 antibody, Cach antibody, STARD15 antibody, THEAL antibody, 1300004O04Rik antibody, 4930449F15Rik antibody, AV027244 antibody, mCACH-1 antibody, rACH antibody, acyl-CoA thioesterase 12 antibody, acyl-CoA thioesterase 12 L homeolog antibody, ACOT12 antibody, acot12 antibody, acot12.L antibody, Acot12 antibody

Background: ACOT12 contains 2 acyl coenzyme A hydrolase domains and 1 START domain. It hydrolyzes acetyl-CoA to acetate and CoA.

Molecular Weight: 62 kDa (MW of target protein)