WDR63 antibody (Middle Region)

Catalog No. ABIN632728

Product Details anti-WDR63 Antibody

Target: WDR63 (WD Repeat Domain 63 (WDR63))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR63 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR63 antibody was raised against the middle region of WDR63

Purification: Affinity purified

Immunogen: WDR63 antibody was raised using the middle region of WDR63 corresponding to a region with amino acids EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR63 Blocking Peptide, catalog no. 33R-2463, is also available for use as a blocking control in assays to test for specificity of this WDR63 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR63

Target: WDR63 (WD Repeat Domain 63 (WDR63))

Alternative Name: WDR63 (WDR63 Products)

Synonyms: DIC3 antibody, NYD-SP29 antibody, RP11-507C22.2 antibody, 4931433A13Rik antibody, RGD1563105 antibody, WD repeat domain 63 antibody, WDR63 antibody, Wdr63 antibody

Background: WDR63 contains 5 WD repeats. The exact function of WDR63 is not known.

Molecular Weight: 103 kDa (MW of target protein)