FAM161B antibody (Middle Region)

Catalog No. ABIN632736

Product Details anti-FAM161B Antibody

Target: FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM161B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF44 antibody was raised against the middle region of C14 rf44

Purification: Affinity purified

Immunogen: C14 ORF44 antibody was raised using the middle region of C14 rf44 corresponding to a region with amino acids AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF44 Blocking Peptide, catalog no. 33R-1385, is also available for use as a blocking control in assays to test for specificity of this C14ORF44 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF44 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM161B

Target: FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))

Alternative Name: C14ORF44 (FAM161B Products)

Synonyms: C14orf44 antibody, c14_5547 antibody, 9330169D17 antibody, 9830169C18Rik antibody, RGD1309058 antibody, family with sequence similarity 161 member B antibody, family with sequence similarity 161, member B antibody, FAM161B antibody, Fam161b antibody

Background: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 74 kDa (MW of target protein)