C12ORF50 antibody (N-Term)

Catalog No. ABIN632742

The Rabbit Polyclonal anti-C12ORF50 antibody (ABIN632742) specifically detects C12ORF50 in WB. The antibody is reactive with Human samples.

Quick Overview for C12ORF50 antibody (N-Term) (ABIN632742)

Target: C12ORF50 (Chromosome 12 Open Reading Frame 50 (C12ORF50))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C12ORF50 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C12ORF50 Antibody

Binding Specificity: N-Term

Specificity: C12 ORF50 antibody was raised against the N terminal Of C12 rf50

Purification: Affinity purified

Immunogen: C12 ORF50 antibody was raised using the N terminal Of C12 rf50 corresponding to a region with amino acids INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C12ORF50 Blocking Peptide, (ABIN939458), is also available for use as a blocking control in assays to test for specificity of this C12ORF50 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C12ORF50

Target: C12ORF50 (Chromosome 12 Open Reading Frame 50 (C12ORF50))

Alternative Name: C12ORF50

Background: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 47 kDa (MW of target protein)