PSTK antibody (Middle Region)

Catalog No. ABIN632756

Product Details anti-PSTK Antibody

Target: PSTK (Phosphoseryl-tRNA Kinase (PSTK))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSTK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PSTK antibody was raised against the middle region of PSTK

Purification: Affinity purified

Immunogen: PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSTK Blocking Peptide, catalog no. 33R-8766, is also available for use as a blocking control in assays to test for specificity of this PSTK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSTK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSTK

Target: PSTK (Phosphoseryl-tRNA Kinase (PSTK))

Alternative Name: PSTK (PSTK Products)

Synonyms: C10orf89 antibody, 5430423O14Rik antibody, 5730458D16Rik antibody, Gm1099 antibody, R75284 antibody, Pstk antibody, phosphoseryl-tRNA kinase antibody, phosphoseryl-tRNA kinase L homeolog antibody, PSTK antibody, pstk antibody, pstk.L antibody, Pstk antibody

Background: PSTK specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis.

Molecular Weight: 39 kDa (MW of target protein)