FAM71A antibody (C-Term)

Catalog No. ABIN632763

Product Details anti-FAM71A Antibody

Target: FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM71A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM71 A antibody was raised against the C terminal of FAM71

Purification: Affinity purified

Immunogen: FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM71A Blocking Peptide, catalog no. 33R-2019, is also available for use as a blocking control in assays to test for specificity of this FAM71A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM71A

Target: FAM71A (Family with Sequence Similarity 71, Member A (FAM71A))

Alternative Name: FAM71A (FAM71A Products)

Synonyms: RGD1561646 antibody, GARI-L4 antibody, 4933417M04Rik antibody, RP11-338C15.4 antibody, family with sequence similarity 71, member A antibody, family with sequence similarity 71 member A antibody, Fam71a antibody, FAM71A antibody

Background: FAM71A belongs to the FAM71 family. The exact function of C15orf27 remains unknown.

Molecular Weight: 63 kDa (MW of target protein)