MAGEA4 antibody (C-Term)

Catalog No. ABIN632780

The Rabbit Polyclonal anti-MAGEA4 antibody has been validated for WB. It is suitable to detect MAGEA4 in samples from Human.

Quick Overview for MAGEA4 antibody (C-Term) (ABIN632780)

Target: MAGEA4 (Melanoma Antigen Family A, 4 (MAGEA4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEA4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAGEA4 Antibody

Binding Specificity: C-Term

Specificity: MAGEA4 antibody was raised against the C terminal of MAGEA4

Purification: Affinity purified

Immunogen: MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEA4 Blocking Peptide, (ABIN938006), is also available for use as a blocking control in assays to test for specificity of this MAGEA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEA4

Target: MAGEA4 (Melanoma Antigen Family A, 4 (MAGEA4))

Alternative Name: MAGEA4

Background: MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Molecular Weight: 35 kDa (MW of target protein)