PTGR1 antibody (N-Term)

Catalog No. ABIN632800

Product Details anti-PTGR1 Antibody

Target: PTGR1 (Prostaglandin Reductase 1 (PTGR1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LTB4 DH antibody was raised against the N terminal Of Ltb4 h

Purification: Affinity purified

Immunogen: LTB4 DH antibody was raised using the N terminal Of Ltb4 h corresponding to a region with amino acids VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LTB4DH Blocking Peptide, catalog no. 33R-9791, is also available for use as a blocking control in assays to test for specificity of this LTB4DH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB0 H antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTGR1

Target: PTGR1 (Prostaglandin Reductase 1 (PTGR1))

Alternative Name: LTB4DH (PTGR1 Products)

Synonyms: LTB4DH antibody, PGR1 antibody, ZADH3 antibody, 2510002C21Rik antibody, Ltb4dh antibody, Dig1 antibody, ltb4dh antibody, wu:fj35e05 antibody, zgc:101689 antibody, PTGR1 antibody, prostaglandin reductase 1 antibody, PTGR1 antibody, Ptgr1 antibody, ptgr1 antibody

Background: LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Molecular Weight: 36 kDa (MW of target protein)