EML3 antibody (N-Term)

Catalog No. ABIN632829

Product Details anti-EML3 Antibody

Target: EML3 (Echinoderm Microtubule Associated Protein Like 3 (EML3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EML3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EML3 antibody was raised against the N terminal of EML3

Purification: Affinity purified

Immunogen: EML3 antibody was raised using the N terminal of EML3 corresponding to a region with amino acids LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EML3 Blocking Peptide, catalog no. 33R-5198, is also available for use as a blocking control in assays to test for specificity of this EML3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EML3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EML3

Target: EML3 (Echinoderm Microtubule Associated Protein Like 3 (EML3))

Alternative Name: EML3 (EML3 Products)

Synonyms: BC022146 antibody, ELP95 antibody, RGD1311368 antibody, echinoderm microtubule associated protein like 3 antibody, Eml3 antibody, EML3 antibody

Background: EML3 may modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.

Molecular Weight: 95 kDa (MW of target protein)