GANC antibody (Middle Region)
-
- Target See all GANC Antibodies
- GANC (Glucosidase, Alpha, Neutral C (GANC))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GANC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GANC antibody was raised against the middle region of GANC
- Purification
- Affinity purified
- Immunogen
- GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR
- Top Product
- Discover our top product GANC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GANC Blocking Peptide, catalog no. 33R-9658, is also available for use as a blocking control in assays to test for specificity of this GANC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GANC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GANC (Glucosidase, Alpha, Neutral C (GANC))
- Alternative Name
- GANC (GANC Products)
- Synonyms
- 5830445O15Rik antibody, 9330160A12 antibody, mFLJ00088 antibody, glucosidase alpha, neutral C antibody, calpain-3 antibody, glucosidase, alpha; neutral C antibody, GANC antibody, LOC453361 antibody, ganc antibody, Ganc antibody
- Background
- GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.
- Molecular Weight
- 104 kDa (MW of target protein)
-