C1orf103 antibody (N-Term)

Catalog No. ABIN632871

The Rabbit Polyclonal anti-C1orf103 antibody (ABIN632871) specifically detects C1orf103 in WB. The antibody is reactive with Human samples.

Quick Overview for C1orf103 antibody (N-Term) (ABIN632871)

Target: C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf103 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C1orf103 Antibody

Binding Specificity: N-Term

Specificity: C1 ORF103 antibody was raised against the N terminal Of C1 rf103

Purification: Affinity purified

Immunogen: C1 ORF103 antibody was raised using the N terminal Of C1 rf103 corresponding to a region with amino acids KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF103 Blocking Peptide, (ABIN939858), is also available for use as a blocking control in assays to test for specificity of this C1ORF103 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF103 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf103

Target: C1orf103 (Chromosome 1 Open Reading Frame 103 (C1orf103))

Alternative Name: C1ORF103

Background: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Nuclear Hormone Receptor Binding