CHAC2 antibody

Catalog No. ABIN632873

Product Details anti-CHAC2 Antibody

Target: CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHAC2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CHAC2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHAC2 Blocking Peptide, catalog no. 33R-6622, is also available for use as a blocking control in assays to test for specificity of this CHAC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHAC2

Target: CHAC2 (ChaC, Cation Transport Regulator Homolog 2 (CHAC2))

Alternative Name: CHAC2 (CHAC2 Products)

Synonyms: 2510006C20Rik antibody, chac antibody, fj84c08 antibody, im:7150709 antibody, wu:fj84c08 antibody, zgc:110055 antibody, RGD1309120 antibody, ChaC cation transport regulator homolog 2 antibody, ChaC, cation transport regulator homolog 2 antibody, ChaC, cation transport regulator 2 antibody, ChaC, cation transport regulator homolog 2 S homeolog antibody, ChaC, cation transport regulator homolog 2 (E. coli) antibody, ChaC cation transport regulator 2 antibody, CHAC2 antibody, chac2 antibody, Chac2 antibody, chac2.S antibody

Background: The function of CHAC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 21 kDa (MW of target protein)