PBLD1 antibody (N-Term)

Catalog No. ABIN632880

This anti-PBLD1 antibody is a Rabbit Polyclonal antibody detecting PBLD1 in WB. Suitable for Human.

Quick Overview for PBLD1 antibody (N-Term) (ABIN632880)

Target: PBLD1 (Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PBLD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PBLD1 Antibody

Binding Specificity: N-Term

Specificity: PBLD antibody was raised against the N terminal of PBLD

Purification: Affinity purified

Immunogen: PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PBLD Blocking Peptide, (ABIN939912), is also available for use as a blocking control in assays to test for specificity of this PBLD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PBLD1

Target: PBLD1 (Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1))

Alternative Name: PBLD

Background: The function of the PBLD protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 31 kDa (MW of target protein)