MAGEB2 antibody (N-Term)
-
- Target See all MAGEB2 Antibodies
- MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))
-
Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAGEB2 antibody was raised against the N terminal of MAGEB2
- Purification
- Affinity purified
- Immunogen
- MAGEB2 antibody was raised using the N terminal of MAGEB2 corresponding to a region with amino acids MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA
- Top Product
- Discover our top product MAGEB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEB2 Blocking Peptide, catalog no. 33R-6302, is also available for use as a blocking control in assays to test for specificity of this MAGEB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))
- Alternative Name
- MAGEB2 (MAGEB2 Products)
- Synonyms
- MAGEB2 antibody, CT3.2 antibody, DAM6 antibody, MAGE-XP-2 antibody, MAGE family member B2 antibody, MAGEB2 antibody
- Background
- This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.
- Molecular Weight
- 35 kDa (MW of target protein)
-