OAZ2 antibody (Middle Region)

Catalog No. ABIN632895

This anti-OAZ2 antibody is a Rabbit Polyclonal antibody detecting OAZ2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for OAZ2 antibody (Middle Region) (ABIN632895)

Target: OAZ2 (Ornithine Decarboxylase Antizyme 2 (OAZ2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OAZ2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OAZ2 Antibody

Binding Specificity: Middle Region

Specificity: OAZ2 antibody was raised against the middle region of OAZ2

Purification: Affinity purified

Immunogen: OAZ2 antibody was raised using the middle region of OAZ2 corresponding to a region with amino acids PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OAZ2 Blocking Peptide, (ABIN5615102), is also available for use as a blocking control in assays to test for specificity of this OAZ2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAZ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OAZ2

Target: OAZ2 (Ornithine Decarboxylase Antizyme 2 (OAZ2))

Alternative Name: OAZ2

Background: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis.

Molecular Weight: 21 kDa (MW of target protein)