MED31 antibody (N-Term)

Catalog No. ABIN632918

Product Details anti-MED31 Antibody

Target: MED31 (Mediator Complex Subunit 31 (MED31))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MED31 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MED31 antibody was raised against the N terminal of MED31

Purification: Affinity purified

Immunogen: MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MED31 Blocking Peptide, catalog no. 33R-5587, is also available for use as a blocking control in assays to test for specificity of this MED31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MED31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MED31

Target: MED31 (Mediator Complex Subunit 31 (MED31))

Alternative Name: MED31 (MED31 Products)

Synonyms: 3110004H13Rik antibody, Soh1 antibody, CGI-125 antibody, l11Jus15 antibody, RGD1309457 antibody, fa04d01 antibody, zgc:92673 antibody, wu:fa04d01 antibody, CaO19.1429 antibody, cgi-125 antibody, med31 antibody, med31-a antibody, med31-b antibody, med31a antibody, soh1 antibody, soh1-A antibody, mediator complex subunit 31 antibody, Soh1p antibody, mediator complex subunit Med31 antibody, mediator complex subunit 31 L homeolog antibody, MED31 antibody, Med31 antibody, med31 antibody, SOH1 antibody, med31.L antibody

Background: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha