MAP7D1 antibody (N-Term)

Catalog No. ABIN632935

This Rabbit Polyclonal antibody specifically detects MAP7D1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MAP7D1 antibody (N-Term) (ABIN632935)

Target: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP7D1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAP7D1 Antibody

Binding Specificity: N-Term

Specificity: MAP7 D1 antibody was raised against the N terminal of MAP7 1

Purification: Affinity purified

Immunogen: MAP7 D1 antibody was raised using the N terminal of MAP7 1 corresponding to a region with amino acids RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP7D1 Blocking Peptide, (ABIN5614659), is also available for use as a blocking control in assays to test for specificity of this MAP7D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP7D1

Target: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Alternative Name: MAP7D1

Background: The function of MAP7 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 93 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection