DNAAF2 antibody (N-Term)

Catalog No. ABIN632937

This anti-DNAAF2 antibody is a Rabbit Polyclonal antibody detecting DNAAF2 in WB. Suitable for Human.

Quick Overview for DNAAF2 antibody (N-Term) (ABIN632937)

Target: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAAF2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNAAF2 Antibody

Binding Specificity: N-Term

Specificity: C14 ORF104 antibody was raised against the N terminal Of C14 rf104

Purification: Affinity purified

Immunogen: C14 ORF104 antibody was raised using the N terminal Of C14 rf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF104 Blocking Peptide, (ABIN5612406), is also available for use as a blocking control in assays to test for specificity of this C14ORF104 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF104 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAAF2

Target: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Alternative Name: C14ORF104

Background: This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 91 kDa (MW of target protein)