SMG8 antibody (Middle Region)

Catalog No. ABIN632938

This Rabbit Polyclonal antibody specifically detects SMG8 in WB. It exhibits reactivity toward Human.

Quick Overview for SMG8 antibody (Middle Region) (ABIN632938)

Target: SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMG8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SMG8 Antibody

Binding Specificity: Middle Region

Specificity: C17 ORF71 antibody was raised against the middle region of C17 rf71

Purification: Affinity purified

Immunogen: C17 ORF71 antibody was raised using the middle region of C17 rf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C17ORF71 Blocking Peptide, (ABIN939088), is also available for use as a blocking control in assays to test for specificity of this C17ORF71 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF71 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMG8

Target: SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))

Alternative Name: C17ORF71

Background: The C17ORF71 protein is a component of the SMG1C complex, a mRNA surveillance complex that recognises and degrades mRNAs containing premature translation termination codons (PTCs) via the nonsense-mediated mRNA decay (NMD). The complex probably acts by associating with ribosomes during tranlation termination on mRNPs. If an exon junction complex (EJC) is located 50-55 or more nucleotides downstream from the termination codon, SMG1 phosphorylates UPF1/RENT1, triggering nonsense-mediated mRNA decay (NMD).

Molecular Weight: 110 kDa (MW of target protein)