SASH3 antibody (N-Term)

Catalog No. ABIN632950

Product Details anti-SASH3 Antibody

Target: SASH3 (SAM and SH3 Domain Containing 3 (SASH3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SASH3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CXORF9 antibody was raised against the N terminal Of Cxorf9

Purification: Affinity purified

Immunogen: CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CXORF9 Blocking Peptide, catalog no. 33R-4594, is also available for use as a blocking control in assays to test for specificity of this CXORF9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SASH3

Target: SASH3 (SAM and SH3 Domain Containing 3 (SASH3))

Alternative Name: CXORF9 (SASH3 Products)

Synonyms: 753P9 antibody, CXorf9 antibody, HACS2 antibody, SH3D6C antibody, SLY antibody, 1200013B08Rik antibody, AW413946 antibody, SLY1 antibody, HXCXORF9 antibody, SAM and SH3 domain containing 3 antibody, SASH3 antibody, Sash3 antibody

Background: The CXORF9 protein contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response