GLRX3 antibody (N-Term)

Catalog No. ABIN632963

Product Details anti-GLRX3 Antibody

Target: GLRX3 (Glutaredoxin 3 (GLRX3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLRX3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLRX3 antibody was raised against the N terminal of GLRX3

Purification: Affinity purified

Immunogen: GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLRX3 Blocking Peptide, catalog no. 33R-5905, is also available for use as a blocking control in assays to test for specificity of this GLRX3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLRX3

Target: GLRX3 (Glutaredoxin 3 (GLRX3))

Alternative Name: GLRX3 (GLRX3 Products)

Synonyms: GLRX4 antibody, GRX3 antibody, GRX4 antibody, PICOT antibody, TXNL2 antibody, TXNL3 antibody, Txnl2 antibody, txnl2 antibody, wu:fb38e09 antibody, zgc:103648 antibody, NME/NM23 family member 9 antibody, thioredoxin-like 2 antibody, glutaredoxin 3 antibody, NME9 antibody, LOC100285323 antibody, GLRX3 antibody, Glrx3 antibody, glrx3 antibody

Background: GLRX3 may play a role in regulating the function of the thioredoxin system.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis