NT5C1B antibody (N-Term)
-
- Target See all NT5C1B Antibodies
- NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NT5C1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NT5 C5 antibody was raised against the N terminal of NT5 5
- Purification
- Affinity purified
- Immunogen
- NT5 C5 antibody was raised using the N terminal of NT5 5 corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT
- Top Product
- Discover our top product NT5C1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NT5C1B Blocking Peptide, catalog no. 33R-6484, is also available for use as a blocking control in assays to test for specificity of this NT5C1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))
- Alternative Name
- NT5C1B (NT5C1B Products)
- Synonyms
- 4921514H13Rik antibody, AIRP antibody, CN-IB antibody, Rdh14 antibody, CN1B antibody, zgc:163054 antibody, 5'-nucleotidase, cytosolic IB antibody, 5'-nucleotidase, cytosolic IB a antibody, Nt5c1b antibody, NT5C1B antibody, nt5c1ba antibody
- Background
- Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.
- Molecular Weight
- 61 kDa (MW of target protein)
-