FAM78A antibody (N-Term)

Catalog No. ABIN633017

Product Details anti-FAM78A Antibody

Target: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM78A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM78 A antibody was raised against the N terminal of FAM78

Purification: Affinity purified

Immunogen: FAM78 A antibody was raised using the N terminal of FAM78 corresponding to a region with amino acids MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM78A Blocking Peptide, catalog no. 33R-6279, is also available for use as a blocking control in assays to test for specificity of this FAM78A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM78A

Target: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Alternative Name: FAM78A (FAM78A Products)

Synonyms: fam78a antibody, zgc:175187 antibody, C9orf59 antibody, A130092J06Rik antibody, RGD1566351 antibody, family with sequence similarity 78 member A antibody, family with sequence similarity 78, member Ab antibody, family with sequence similarity 78, member A antibody, FAM78A antibody, fam78ab antibody, fam78a antibody, Fam78a antibody

Background: The function of FAM78A has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 32 kDa (MW of target protein)