S100PBP antibody (Middle Region)

Catalog No. ABIN633020

Product Details anti-S100PBP Antibody

Target: S100PBP (S100P Binding Protein (S100PBP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This S100PBP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: S100 PBP antibody was raised against the middle region of S100 BP

Purification: Affinity purified

Immunogen: S100 PBP antibody was raised using the middle region of S100 BP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

S100PBP Blocking Peptide, catalog no. 33R-2713, is also available for use as a blocking control in assays to test for specificity of this S100PBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 BP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for S100PBP

Target: S100PBP (S100P Binding Protein (S100PBP))

Alternative Name: S100PBP (S100PBP Products)

Synonyms: s100pbpr antibody, S100PBPR antibody, 4930429A08Rik antibody, AI851343 antibody, S100pbpr antibody, RGD1564943 antibody, S100P binding protein antibody, S100P binding protein L homeolog antibody, S100PBP antibody, s100pbp antibody, S100pbp antibody, s100pbp.L antibody

Background: The function of S100PBP protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 37 kDa (MW of target protein)