APIP antibody (Middle Region)
-
- Target See all APIP Antibodies
- APIP (APAF1 Interacting Protein (APIP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APIP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- APIP antibody was raised against the middle region of APIP
- Purification
- Affinity purified
- Immunogen
- APIP antibody was raised using the middle region of APIP corresponding to a region with amino acids GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV
- Top Product
- Discover our top product APIP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
APIP Blocking Peptide, catalog no. 33R-3330, is also available for use as a blocking control in assays to test for specificity of this APIP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APIP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APIP (APAF1 Interacting Protein (APIP))
- Alternative Name
- APIP (APIP Products)
- Background
- APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-