APIP antibody (Middle Region)

Catalog No. ABIN633024

This anti-APIP antibody is a Rabbit Polyclonal antibody detecting APIP in WB. Suitable for Human, Mouse and Rat.

Quick Overview for APIP antibody (Middle Region) (ABIN633024)

Target: APIP (APAF1 Interacting Protein (APIP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APIP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APIP Antibody

Binding Specificity: Middle Region

Specificity: APIP antibody was raised against the middle region of APIP

Purification: Affinity purified

Immunogen: APIP antibody was raised using the middle region of APIP corresponding to a region with amino acids GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APIP Blocking Peptide, (ABIN938716), is also available for use as a blocking control in assays to test for specificity of this APIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APIP

Target: APIP (APAF1 Interacting Protein (APIP))

Alternative Name: APIP

Background: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process