C21orf58 antibody (N-Term)

Catalog No. ABIN633031

Product Details anti-C21orf58 Antibody

Target: C21orf58 (Chromosome 21 Open Reading Frame 58 (C21orf58))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C21orf58 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C21 orf58 antibody was raised against the N terminal of C21 rf58

Purification: Affinity purified

Immunogen: C21 orf58 antibody was raised using the N terminal of C21 rf58 corresponding to a region with amino acids MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21orf58 Blocking Peptide, catalog no. 33R-5735, is also available for use as a blocking control in assays to test for specificity of this C21orf58 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 rf58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C21orf58

Target: C21orf58 (Chromosome 21 Open Reading Frame 58 (C21orf58))

Alternative Name: C21orf58 (C21orf58 Products)

Synonyms: chromosome 21 open reading frame 58 antibody, chromosome 7 C21orf58 homolog antibody, C21orf58 antibody, C7H21orf58 antibody

Background: The function of Chromosome 21 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 35 kDa (MW of target protein)