FGL2 antibody (Middle Region)

Catalog No. ABIN633034

This Rabbit Polyclonal antibody specifically detects FGL2 in WB. It exhibits reactivity toward Human.

Quick Overview for FGL2 antibody (Middle Region) (ABIN633034)

Target: FGL2 (Fibrinogen-Like 2 (FGL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FGL2 Antibody

Binding Specificity: Middle Region

Specificity: FGL2 antibody was raised against the middle region of FGL2

Purification: Affinity purified

Immunogen: FGL2 antibody was raised using the middle region of FGL2 corresponding to a region with amino acids WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FGL2 Blocking Peptide, (ABIN935985), is also available for use as a blocking control in assays to test for specificity of this FGL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FGL2

Target: FGL2 (Fibrinogen-Like 2 (FGL2))

Alternative Name: FGL2

Background: The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.

Molecular Weight: 48 kDa (MW of target protein)