SULT1E1 antibody (Middle Region)

Catalog No. ABIN633046

This Rabbit Polyclonal antibody specifically detects SULT1E1 in WB. It exhibits reactivity toward Human.

Quick Overview for SULT1E1 antibody (Middle Region) (ABIN633046)

Target: SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULT1E1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SULT1E1 Antibody

Binding Specificity: Middle Region

Specificity: SULT1 E1 antibody was raised against the middle region of SULT1 1

Purification: Affinity purified

Immunogen: SULT1 E1 antibody was raised using the middle region of SULT1 1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULT1E1 Blocking Peptide, (ABIN5616455), is also available for use as a blocking control in assays to test for specificity of this SULT1E1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULT1E1

Target: SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))

Alternative Name: SULT1E1

Background: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis