SULT1E1 antibody (Middle Region)

Catalog No. ABIN633046

Product Details anti-SULT1E1 Antibody

Target: SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULT1E1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SULT1 E1 antibody was raised against the middle region of SULT1 1

Purification: Affinity purified

Immunogen: SULT1 E1 antibody was raised using the middle region of SULT1 1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULT1E1 Blocking Peptide, catalog no. 33R-5214, is also available for use as a blocking control in assays to test for specificity of this SULT1E1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULT1E1

Target: SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))

Alternative Name: SULT1E1 (SULT1E1 Products)

Background: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis