PNKP antibody (N-Term)

Catalog No. ABIN633050

The Rabbit Polyclonal anti-PNKP antibody has been validated for WB. It is suitable to detect PNKP in samples from Human.

Quick Overview for PNKP antibody (N-Term) (ABIN633050)

Target: PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNKP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PNKP Antibody

Binding Specificity: N-Term

Specificity: PNKP antibody was raised against the N terminal of PNKP

Purification: Affinity purified

Immunogen: PNKP antibody was raised using the N terminal of PNKP corresponding to a region with amino acids MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNKP Blocking Peptide, (ABIN5615433), is also available for use as a blocking control in assays to test for specificity of this PNKP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNKP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNKP

Target: PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))

Alternative Name: PNKP

Background: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: DNA Damage Repair, Nucleotide Phosphorylation