PNKP antibody (Middle Region)
-
- Target See all PNKP Antibodies
- PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNKP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PNKP antibody was raised against the middle region of PNKP
- Purification
- Affinity purified
- Immunogen
- PNKP antibody was raised using the middle region of PNKP corresponding to a region with amino acids ALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTT
- Top Product
- Discover our top product PNKP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PNKP Blocking Peptide, catalog no. 33R-1356, is also available for use as a blocking control in assays to test for specificity of this PNKP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNKP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))
- Alternative Name
- PNKP (PNKP Products)
- Synonyms
- EIEE10 antibody, MCSZ antibody, PNK antibody, Tb06.28P18.320 antibody, 21.m03011 antibody, 1810009G08Rik antibody, polynucleotide kinase 3'-phosphatase antibody, hypothetical protein antibody, polynucleotide kinase 3'- phosphatase antibody, PNKP antibody, Pnkp antibody, Tc00.1047053507017.50 antibody, Tc00.1047053505807.190 antibody, Tb927.6.1580 antibody, BBOV_IV000690 antibody, CC1G_05202 antibody, PGTG_20262 antibody, PGTG_18987 antibody, pnkp.S antibody, pnkp antibody
- Background
- This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- DNA Damage Repair, Nucleotide Phosphorylation
-