FTO antibody (Middle Region)
-
- Target See all FTO Antibodies
- FTO (Fat Mass and Obesity-Associated (FTO))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FTO antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FTO antibody was raised against the middle region of FTO
- Purification
- Affinity purified
- Immunogen
- FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA
- Top Product
- Discover our top product FTO Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FTO Blocking Peptide, catalog no. 33R-10037, is also available for use as a blocking control in assays to test for specificity of this FTO antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTO antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FTO (Fat Mass and Obesity-Associated (FTO))
- Alternative Name
- FTO (FTO Products)
- Background
- The exact function of this gene is not known. Studies in mice suggest that it may be involved in nucleic acid demethylation, and that its mRNA level is regulated by feeding and fasting. Genomewide association studies of type 2 diabetes indicate this gene as a diabetes susceptibility locus. Mutation in this gene has been associated with growth retardation, developmental delay, coarse facies, and early death.
- Molecular Weight
- 58 kDa (MW of target protein)
-