CRP antibody (N-Term)

Catalog No. ABIN633100

This Rabbit Polyclonal antibody specifically detects CRP in WB. It exhibits reactivity toward Human.

Quick Overview for CRP antibody (N-Term) (ABIN633100)

Target: CRP (C-Reactive Protein (CRP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CRP Antibody

Binding Specificity: N-Term

Specificity: CRP antibody was raised against the N terminal of CRP

Purification: Affinity purified

Immunogen: CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRP Blocking Peptide, (ABIN5613007), is also available for use as a blocking control in assays to test for specificity of this CRP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRP

Target: CRP (C-Reactive Protein (CRP))

Alternative Name: C-Reactive Protein

Background: The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis