COX7B antibody (Cytochrome C Oxidase Subunit VIIb) (N-Term)

Details for Product anti-COX7B Antibody No. ABIN633101
Antigen
  • APLCC
  • 1100001F07Rik
  • 1110004F07Rik
  • C80563
  • MGC86432
  • MGC147245
  • fk47c09
  • wu:fk47c09
  • zgc:194876
  • IHQ
  • cytochrome c oxidase subunit 7B
  • cytochrome c oxidase subunit VIIb
  • cytochrome c oxidase subunit VIIb L homeolog
  • COX7B
  • Cox7b
  • cox7b.L
  • cox7b
Epitope
N-Term
3
Reactivity
Human
22
10
8
1
1
1
Host
Rabbit
22
Clonality
Polyclonal
Conjugate
This COX7B antibody is un-conjugated
1
1
1
1
1
1
1
Application
Western Blotting (WB)
15
11
11
Options
Immunogen COX7 B antibody was raised using the N terminal of COX7 corresponding to a region with amino acids MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI
Specificity COX7 B antibody was raised against the N terminal of COX7
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others COX7B products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name COX7B (COX7B Antibody Abstract)
Background Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22, respectively.
Molecular Weight 6 kDa (MW of target protein)
Pathways Proton Transport
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

COX7B Blocking Peptide, catalog no. 33R-6000, is also available for use as a blocking control in assays to test for specificity of this COX7B antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Cytochrome C Oxidase Subunit VIIb (COX7B) (N-Term) antibody (ABIN633101) COX7B antibody used at 1 ug/ml to detect target protein.
Did you look for something else?