SAAL1 antibody (Middle Region)

Catalog No. ABIN633139

Product Details anti-SAAL1 Antibody

Target: SAAL1 (serum Amyloid A-Like 1 (SAAL1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAAL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SAAL1 antibody was raised against the middle region of SAAL1

Purification: Affinity purified

Immunogen: SAAL1 antibody was raised using the middle region of SAAL1 corresponding to a region with amino acids EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAAL1 Blocking Peptide, catalog no. 33R-2513, is also available for use as a blocking control in assays to test for specificity of this SAAL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAAL1

Target: SAAL1 (serum Amyloid A-Like 1 (SAAL1))

Alternative Name: SAAL1 (SAAL1 Products)

Synonyms: SPACIA1 antibody, 5031425D22Rik antibody, zgc:55505 antibody, serum amyloid A like 1 antibody, serum amyloid A-like 1 antibody, SAAL1 antibody, Saal1 antibody, saal1 antibody

Background: The function of SAA protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome