SAAL1 antibody (N-Term)

Catalog No. ABIN633143

The Rabbit Polyclonal anti-SAAL1 antibody has been validated for WB. It is suitable to detect SAAL1 in samples from Human.

Quick Overview for SAAL1 antibody (N-Term) (ABIN633143)

Target: SAAL1 (serum Amyloid A-Like 1 (SAAL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAAL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SAAL1 Antibody

Binding Specificity: N-Term

Specificity: SAAL1 antibody was raised against the N terminal of SAAL1

Purification: Affinity purified

Immunogen: SAAL1 antibody was raised using the N terminal of SAAL1 corresponding to a region with amino acids MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAAL1 Blocking Peptide, (ABIN5615991), is also available for use as a blocking control in assays to test for specificity of this SAAL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAAL1

Target: SAAL1 (serum Amyloid A-Like 1 (SAAL1))

Alternative Name: SAAL1

Background: The SAAL1 protein may be involved in binding.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome