BBS4 antibody (Middle Region)
-
- Target See all BBS4 Antibodies
- BBS4 (Bardet-Biedl Syndrome 4 (BBS4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BBS4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BBS4 antibody was raised against the middle region of BBS4
- Purification
- Affinity purified
- Immunogen
- BBS4 antibody was raised using the middle region of BBS4 corresponding to a region with amino acids LGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVAC
- Top Product
- Discover our top product BBS4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BBS4 Blocking Peptide, catalog no. 33R-4978, is also available for use as a blocking control in assays to test for specificity of this BBS4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BBS4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BBS4 (Bardet-Biedl Syndrome 4 (BBS4))
- Alternative Name
- BBS4 (BBS4 Products)
- Synonyms
- CG13232 antibody, Dmel\\CG13232 antibody, zgc:152964 antibody, AW537059 antibody, AW742241 antibody, D9Ertd464e antibody, Bardet-Biedl syndrome 4 antibody, bardet-biedl syndrome 4 antibody, Bardet-Biedl syndrome 4 (human) antibody, BBS4 antibody, bbs4 antibody, Bbs4 antibody
- Background
- This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse. The similar phenotypes exhibited by mutations in BBS gene family members are likely due to the protein's shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling, Tube Formation, Maintenance of Protein Location
-