CRNN antibody (Middle Region)

Catalog No. ABIN633156

Product Details anti-CRNN Antibody

Target: CRNN (Cornulin (CRNN))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRNN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cornulin antibody was raised against the middle region of CRNN

Purification: Affinity purified

Immunogen: Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cornulin Blocking Peptide, catalog no. 33R-3210, is also available for use as a blocking control in assays to test for specificity of this Cornulin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRNN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRNN

Target: CRNN (Cornulin (CRNN))

Alternative Name: Cornulin (CRNN Products)

Synonyms: C1orf10 antibody, DRC1 antibody, PDRC1 antibody, SEP53 antibody, RGD1311778 antibody, Gm1015 antibody, cornulin antibody, CRNN antibody, Crnn antibody, LOC100359146 antibody

Background: This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.

Molecular Weight: 52 kDa (MW of target protein)