PURB antibody (N-Term)
-
- Target See all PURB Antibodies
- PURB (Purine-Rich Element Binding Protein B (PURB))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PURB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PURB antibody was raised against the N terminal of PURB
- Purification
- Affinity purified
- Immunogen
- PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV
- Top Product
- Discover our top product PURB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PURB Blocking Peptide, catalog no. 33R-5621, is also available for use as a blocking control in assays to test for specificity of this PURB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PURB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PURB (Purine-Rich Element Binding Protein B (PURB))
- Alternative Name
- PURB (PURB Products)
- Synonyms
- 2310015K15Rik antibody, AA114818 antibody, Cager-2 antibody, D11Bwg0414e antibody, pur-beta antibody, purb antibody, zgc:65916 antibody, purb-b antibody, purbeta antibody, PURBETA antibody, si:dkey-202n14.1 antibody, purine rich element binding protein B antibody, purine-rich element binding protein Bb antibody, purine-rich element binding protein B L homeolog antibody, purine-rich element binding protein Ba antibody, Purb antibody, purbb antibody, purb.L antibody, PURB antibody, purba antibody
- Background
- This gene product is a sequence-specific, single-stranded DNA-binding protein.
- Molecular Weight
- 33 kDa (MW of target protein)
-