RECQL5 antibody (Middle Region)

Catalog No. ABIN633185

The Rabbit Polyclonal anti-RECQL5 antibody is suitable to detect RECQL5 in samples from Human. It has been validated for WB.

Quick Overview for RECQL5 antibody (Middle Region) (ABIN633185)

Target: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RECQL5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RECQL5 Antibody

Binding Specificity: Middle Region

Specificity: RecQL5 antibody was raised against the middle region of RECQL5

Purification: Affinity purified

Immunogen: RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RecQL5 Blocking Peptide, (ABIN937047), is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RECQL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RECQL5

Target: RECQL5 (RecQ Protein-Like 5 (RECQL5))

Alternative Name: RecQL5

Background: RECQL5 may have an important role in DNA metabolism.

Molecular Weight: 109 kDa (MW of target protein)