DAZ1 antibody (N-Term)

Catalog No. ABIN633207

This anti-DAZ1 antibody is a Rabbit Polyclonal antibody detecting DAZ1 in WB. Suitable for Human.

Quick Overview for DAZ1 antibody (N-Term) (ABIN633207)

Target: DAZ1 (Deleted in Azoospermia 1 (DAZ1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAZ1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DAZ1 Antibody

Binding Specificity: N-Term

Specificity: DAZ1 antibody was raised against the N terminal of DAZ1

Purification: Affinity purified

Immunogen: DAZ1 antibody was raised using the N terminal of DAZ1 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAZ1 Blocking Peptide, (ABIN5613122), is also available for use as a blocking control in assays to test for specificity of this DAZ1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAZ1

Target: DAZ1 (Deleted in Azoospermia 1 (DAZ1))

Alternative Name: DAZ1

Background: DAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.

Molecular Weight: 64 kDa (MW of target protein)