SRP68 antibody (N-Term)

Catalog No. ABIN633214

Product Details anti-SRP68 Antibody

Target: SRP68 (Signal Recognition Particle 68kDa (SRP68))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRP68 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SRP68 antibody was raised against the N terminal of SRP68

Purification: Affinity purified

Immunogen: SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRP68 Blocking Peptide, catalog no. 33R-2378, is also available for use as a blocking control in assays to test for specificity of this SRP68 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP68 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRP68

Target: SRP68 (Signal Recognition Particle 68kDa (SRP68))

Alternative Name: SRP68 (SRP68 Products)

Synonyms: 2610024I03Rik antibody, CG5064 antibody, Dmel\\CG5064 antibody, zgc:92573 antibody, Signal recognition particle 68kDa antibody, signal recognition particle 68 antibody, Signal recognition particle protein 68 antibody, signal recognition particle 68kDa L homeolog antibody, GL50803_8916 antibody, SRP68 antibody, Srp68 antibody, srp68 antibody, srp68.L antibody

Background: The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. SRP68 is the 68kDa component of the SRP.

Molecular Weight: 71 kDa (MW of target protein)