HNRNPR antibody (N-Term)

Catalog No. ABIN633229

Product Details anti-HNRNPR Antibody

Target: HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HNRNPR antibody was raised against the N terminal of HNRNPR

Purification: Affinity purified

Immunogen: HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRNPR Blocking Peptide, catalog no. 33R-1408, is also available for use as a blocking control in assays to test for specificity of this HNRNPR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPR

Target: HNRNPR (Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR))

Alternative Name: HNRNPR (HNRNPR Products)

Synonyms: hnrpr antibody, wu:fb97a09 antibody, wu:fe01h03 antibody, zgc:56523 antibody, HNRPR antibody, hnRNP R antibody, hnRNP-R antibody, 2610003J05Rik antibody, 2610528B01Rik antibody, Hnrpr antibody, heterogeneous nuclear ribonucleoprotein R antibody, hnrnpr antibody, HNRNPR antibody, Hnrnpr antibody

Background: HNRNPR belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molecular Weight: 71 kDa (MW of target protein)