NXF1 antibody (N-Term)

Catalog No. ABIN633230

The Rabbit Polyclonal anti-NXF1 antibody has been validated for WB. It is suitable to detect NXF1 in samples from Human and Dog.

Quick Overview for NXF1 antibody (N-Term) (ABIN633230)

Target: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NXF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NXF1 Antibody

Binding Specificity: N-Term

Specificity: NXF1 antibody was raised against the N terminal of NXF1

Purification: Affinity purified

Immunogen: NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NXF1 Blocking Peptide, (ABIN5615091), is also available for use as a blocking control in assays to test for specificity of this NXF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NXF1

Target: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Alternative Name: NXF1

Background: NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.

Molecular Weight: 68 kDa (MW of target protein)