HNRNPH1 antibody (Middle Region)

Catalog No. ABIN633236

Product Details anti-HNRNPH1 Antibody

Target: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPH1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HNRPH1 antibody was raised against the middle region of Hnrph1

Purification: Affinity purified

Immunogen: HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPH1 Blocking Peptide, catalog no. 33R-2975, is also available for use as a blocking control in assays to test for specificity of this HNRPH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPH1

Target: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Alternative Name: HNRPH1 (HNRNPH1 Products)

Synonyms: HNRPH antibody, HNRPH1 antibody, hnRNPH antibody, HNRNPH1 antibody, hnrph antibody, hnrnph antibody, hnrph1 antibody, hnrnph2 antibody, MGC78776 antibody, hnrph2 antibody, MGC80081 antibody, MGC130700 antibody, MGC69543 antibody, AI642080 antibody, E430005G16Rik antibody, Hnrnph antibody, Hnrph1 antibody, Hnrph antibody, zgc:77712 antibody, heterogeneous nuclear ribonucleoprotein H1 antibody, heterogeneous nuclear ribonucleoprotein H2 antibody, heterogeneous nuclear ribonucleoprotein H1 S homeolog antibody, heterogeneous nuclear ribonucleoprotein H1 L homeolog antibody, HNRNPH1 antibody, HNRNPH2 antibody, hnrnph1.S antibody, hnrnph1.L antibody, hnrnph1 antibody, Hnrnph1 antibody

Background: HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molecular Weight: 49 kDa (MW of target protein)