RBM39 antibody (Middle Region)
-
- Target See all RBM39 Antibodies
- RBM39 (RNA Binding Motif Protein 39 (RBM39))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBM39 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBM39 antibody was raised against the middle region of RBM39
- Purification
- Affinity purified
- Immunogen
- RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE
- Top Product
- Discover our top product RBM39 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBM39 Blocking Peptide, catalog no. 33R-3048, is also available for use as a blocking control in assays to test for specificity of this RBM39 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM39 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM39 (RNA Binding Motif Protein 39 (RBM39))
- Alternative Name
- RBM39 (RBM39 Products)
- Background
- RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors.
- Molecular Weight
- 20 kDa (MW of target protein)
-